Skip to content

PEPTAS made-to-order material

Cecropin A

Illustrative image only; physical form for this material is specified in the quotation.
Illustrative image. Physical form for this material is specified in the quotation.
Identity header
Catalog ID PEP-CECA-001
Molecular class Linear peptides
Availability Made to order

Cecropin A is supplied with the molecular formula C184H313N53O46 and an average molecular weight of 4004.0 g/mol.

Quoted per order; schedule confirmed in the quotation.

Request a quotation

Prices are quoted in writing. Quantity, pack format, documentation and destination all affect the price, and each complete request is reviewed before a quotation is issued.

Larger and recurring quantities are quoted through Volume and recurring supply.

This catalog entry records chemical identity information for a laboratory research material. It is not a quotation or a commitment to supply.

Documentation for this item. Analytical documentation available for the material and batch is confirmed in the quotation. What can be requested.

Identity and procurement context

Product information

PEPTAS catalog record

About Cecropin A

The compound is catalogued under CAS number 80451-04-3. These materials are supplied for qualified laboratory research only and are not for human or veterinary use. Any human or veterinary administration, consumption, compounding, or other in-vivo application is strictly prohibited.

Catalog item
Cecropin A
Material class
Synthetic peptide research material
Permitted context
Qualified laboratory research only

Cecropin A specifications

CAS registry number
80451-04-3
Molecular formula
C184H313N53O46
Molecular weight
4004.0 g/mol (average)
Sequence (one-letter)
H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Sequence (three-letter)
H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
Residues
37
Monoisotopic mass
4001.38 Da (calculated)
InChIKey
HCQPHKMLKXOJSR-IRCPFGJUSA-N
PubChem CID
16132345
Physical form
Specified in the quotation
Purity stated on packaging
Specified in the quotation
Storage
Stored and shipped as stated on the packaging and in the order documentation. See Quality control.

These identifiers describe the catalog material. The molecular weight shown is the average mass calculated from the molecular formula above. See Quality control.

Planning work with this material

Calculate reagent quantities using the average molecular weight 4004.0 g/mol. The molecular composition C184H313N53O46 should be considered when assessing stoichiometry. Reference the CAS identifier 80451-04-3 for regulatory documentation. Maintain the item identifier, lot, and storage records together at receipt.

Documentation and order review

Availability, product identity, listed quantity, price, packaging, transport terms, storage information, and any supporting analytical documents are confirmed for the actual item or accepted order. Request the information your project requires before purchasing; a general catalog page cannot replace an order-specific specification or certificate.

  • Confirm purchaser eligibility, destination rules, permits, and institutional approvals.
  • Define identity and analytical acceptance criteria before the material is received.
  • Inspect the package, identifier, quantity, lot information, and documents on arrival.
  • Maintain controlled access, storage, preparation, traceability, and disposal records.

Research-use conditions

Not for human or veterinary use. This material is not a medicine, food, dietary supplement, cosmetic, diagnostic product, or household product. It must not be administered, consumed, compounded for administration, used for self-experimentation, or represented as suitable for the diagnosis, treatment, mitigation, cure, or prevention of any condition.

Purchasers are responsible for lawful acquisition and use, competent risk assessment, suitable facilities and personnel, appropriate personal protective equipment, validated procedures, security, incident response, and waste disposal. Website information is not medical, veterinary, legal, regulatory, or scientific-protocol advice.